SCOPe 2.08: Domain d3ox9b_: 3ox9 B:

Lineage for d3ox9b_ (3ox9 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
   automatically mapped to Pfam PF12680
   automatically mapped to Pfam PF02136

6. Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (3 species)

7. Species Pseudomonas putida [TaxId:303] [54437] (61 PDB entries)
   Uniprot P07445

8. Domain d3ox9b_: 3ox9 B: [183369]
   automated match to d1e3vb_

Details for d3ox9b_

PDB Entry: 3ox9, 2 Å

PDB Description: crystal structure of ketosteroid isomerase d40n/c69s/c81s/c97s/f86c-cn from p. putida

PDB Compounds: (B:) steroid delta-isomerase

SCOPe Domain Sequences for d3ox9b_:

Sequence; same for both SEQRES and ATOM records:

>d3ox9b_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
gggkvrasltgpvrashngsgampxrvemvwngqpsaldvidvmrfdehgriqtmqayws
evnlsvrep

Timeline for d3ox9b_:

• d3ox9b_ first appeared in SCOPe 2.01
  
• d3ox9b_ appears in SCOPe 2.07