Lineage for d3ox9b_ (3ox9 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2543464Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 2543465Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 2543538Species Pseudomonas putida [TaxId:303] [54437] (61 PDB entries)
    Uniprot P07445
  8. 2543639Domain d3ox9b_: 3ox9 B: [183369]
    automated match to d1e3vb_

Details for d3ox9b_

PDB Entry: 3ox9 (more details), 2 Å

PDB Description: crystal structure of ketosteroid isomerase d40n/c69s/c81s/c97s/f86c-cn from p. putida
PDB Compounds: (B:) steroid delta-isomerase

SCOPe Domain Sequences for d3ox9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ox9b_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
gggkvrasltgpvrashngsgampxrvemvwngqpsaldvidvmrfdehgriqtmqayws
evnlsvrep

SCOPe Domain Coordinates for d3ox9b_:

Click to download the PDB-style file with coordinates for d3ox9b_.
(The format of our PDB-style files is described here.)

Timeline for d3ox9b_: