Lineage for d3owyh_ (3owy H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936379Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 2936380Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (3 species)
  7. 2936462Species Pseudomonas putida [TaxId:303] [54437] (61 PDB entries)
    Uniprot P07445
  8. 2936581Domain d3owyh_: 3owy H: [183359]
    automated match to d1e3vb_
    complexed with equ

Details for d3owyh_

PDB Entry: 3owy (more details), 2.3 Å

PDB Description: crystal structure of ketosteroid isomerase d40n/c69s/c81s/c97s/m105c-cn from p. putida with bound equilenin
PDB Compounds: (H:) steroid delta-isomerase

SCOPe Domain Sequences for d3owyh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3owyh_ d.17.4.3 (H:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
gggkvrasltgpvrashngsgampfrvemvwngqpsaldvidvxrfdehgriqtmqayws
evnlsvrep

SCOPe Domain Coordinates for d3owyh_:

Click to download the PDB-style file with coordinates for d3owyh_.
(The format of our PDB-style files is described here.)

Timeline for d3owyh_: