| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins) automatically mapped to Pfam PF12680 automatically mapped to Pfam PF02136 |
| Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (3 species) |
| Species Pseudomonas putida [TaxId:303] [54437] (61 PDB entries) Uniprot P07445 |
| Domain d3owyc_: 3owy C: [183354] automated match to d1e3vb_ complexed with equ |
PDB Entry: 3owy (more details), 2.3 Å
SCOPe Domain Sequences for d3owyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3owyc_ d.17.4.3 (C:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
gggkvrasltgpvrashngsgampfrvemvwngqpsaldvidvxrfdehgriqtmqayws
evnlsvrep
Timeline for d3owyc_: