Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
Protein automated matches [190292] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189658] (4 PDB entries) |
Domain d3ovpa_: 3ovp A: [183320] automated match to d1h1ya_ complexed with fe2, xpe |
PDB Entry: 3ovp (more details), 1.7 Å
SCOPe Domain Sequences for d3ovpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ovpa_ c.1.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gckigpsilnsdlanlgaeclrmldsgadylhldvmdghfvpnitfghpvveslrkqlgq dpffdmhmmvskpeqwvkpmavaganqytfhleatenpgalikdirengmkvglaikpgt sveylapwanqidmalvmtvepgfggqkfmedmmpkvhwlrtqfpsldievdggvgpdtv hkcaeaganmivsgsaimrsedprsvinllrnvcseaaqkr
Timeline for d3ovpa_: