Lineage for d3oupa_ (3oup A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423278Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2423279Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2423517Family b.81.1.5: gamma-carbonic anhydrase-like [51174] (4 proteins)
    archaeal hexapeptide repeat proteins
    this is a repeat family; one repeat unit is 1v3w A:71-88 found in domain
  6. 2423523Protein gamma-carbonic anhydrase [51175] (1 species)
  7. 2423524Species Methanosarcina thermophila [TaxId:2210] [51176] (12 PDB entries)
  8. 2423533Domain d3oupa_: 3oup A: [183303]
    automated match to d1qrla_
    complexed with zn; mutant

Details for d3oupa_

PDB Entry: 3oup (more details), 1.65 Å

PDB Description: crystal structure of the gamma-carbonic anhydrase w19n mutant from methanosarcina thermophila
PDB Compounds: (A:) carbonic anhydrase

SCOPe Domain Sequences for d3oupa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oupa_ b.81.1.5 (A:) gamma-carbonic anhydrase {Methanosarcina thermophila [TaxId: 2210]}
snirenpvtpnnpepsapvidptayidpqasvigevtiganvmvspmasirsdegmpifv
gdrsnvqdgvvlhaletineegepiednivevdgkeyavyignnvslahqsqvhgpaavg
ddtfigmqafvfkskvgnncvleprsaaigvtipdgryipagmvvtsqaeadklpevtdd
yayshtneavvyvnvhlaegykets

SCOPe Domain Coordinates for d3oupa_:

Click to download the PDB-style file with coordinates for d3oupa_.
(The format of our PDB-style files is described here.)

Timeline for d3oupa_: