Class b: All beta proteins [48724] (180 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.5: gamma-carbonic anhydrase-like [51174] (4 proteins) archaeal hexapeptide repeat proteins this is a repeat family; one repeat unit is 1v3w A:71-88 found in domain |
Protein gamma-carbonic anhydrase [51175] (1 species) |
Species Methanosarcina thermophila [TaxId:2210] [51176] (12 PDB entries) |
Domain d3oupa_: 3oup A: [183303] automated match to d1qrla_ complexed with zn; mutant |
PDB Entry: 3oup (more details), 1.65 Å
SCOPe Domain Sequences for d3oupa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oupa_ b.81.1.5 (A:) gamma-carbonic anhydrase {Methanosarcina thermophila [TaxId: 2210]} snirenpvtpnnpepsapvidptayidpqasvigevtiganvmvspmasirsdegmpifv gdrsnvqdgvvlhaletineegepiednivevdgkeyavyignnvslahqsqvhgpaavg ddtfigmqafvfkskvgnncvleprsaaigvtipdgryipagmvvtsqaeadklpevtdd yayshtneavvyvnvhlaegykets
Timeline for d3oupa_: