Lineage for d1ak4c_ (1ak4 C:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1091822Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 1091823Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family) (S)
  5. 1091824Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 1091863Protein HIV-1 capsid protein [47945] (1 species)
  7. 1091864Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (19 PDB entries)
  8. 1091903Domain d1ak4c_: 1ak4 C: [18321]
    Other proteins in same PDB: d1ak4a_, d1ak4b_

Details for d1ak4c_

PDB Entry: 1ak4 (more details), 2.36 Å

PDB Description: human cyclophilin a bound to the amino-terminal domain of hiv-1 capsid
PDB Compounds: (C:) hiv-1 capsid

SCOPe Domain Sequences for d1ak4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ak4c_ a.73.1.1 (C:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmy

SCOPe Domain Coordinates for d1ak4c_:

Click to download the PDB-style file with coordinates for d1ak4c_.
(The format of our PDB-style files is described here.)

Timeline for d1ak4c_: