Lineage for d1abva_ (1abv A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717753Fold a.70: ATPD N-terminal domain-like [47927] (2 superfamilies)
    core: 5 helices; bundle
  4. 2717754Superfamily a.70.1: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47928] (1 family) (S)
    automatically mapped to Pfam PF00213
  5. 2717755Family a.70.1.1: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47929] (1 protein)
  6. 2717756Protein N-terminal domain of the delta subunit of the F1F0-ATP synthase [47930] (1 species)
  7. 2717757Species Escherichia coli [TaxId:562] [47931] (2 PDB entries)
  8. 2717758Domain d1abva_: 1abv A: [18317]

Details for d1abva_

PDB Entry: 1abv (more details)

PDB Description: n-terminal domain of the delta subunit of the f1f0-atp synthase from escherichia coli, nmr, minimized average structure
PDB Compounds: (A:) delta subunit of the f1f0-ATP synthase

SCOPe Domain Sequences for d1abva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1abva_ a.70.1.1 (A:) N-terminal domain of the delta subunit of the F1F0-ATP synthase {Escherichia coli [TaxId: 562]}
sefitvarpyakaafdfavehqsverwqdmlafaaevtkneqmaellsgalapetlaesf
iavcgeqldengqnlirvmaengrlnalpdvleqfihlravseat

SCOPe Domain Coordinates for d1abva_:

Click to download the PDB-style file with coordinates for d1abva_.
(The format of our PDB-style files is described here.)

Timeline for d1abva_: