| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.70: ATPD N-terminal domain-like [47927] (2 superfamilies) core: 5 helices; bundle |
Superfamily a.70.1: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47928] (1 family) ![]() automatically mapped to Pfam PF00213 |
| Family a.70.1.1: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47929] (1 protein) |
| Protein N-terminal domain of the delta subunit of the F1F0-ATP synthase [47930] (1 species) |
| Species Escherichia coli [TaxId:562] [47931] (2 PDB entries) |
| Domain d1abva_: 1abv A: [18317] |
PDB Entry: 1abv (more details)
SCOPe Domain Sequences for d1abva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1abva_ a.70.1.1 (A:) N-terminal domain of the delta subunit of the F1F0-ATP synthase {Escherichia coli [TaxId: 562]}
sefitvarpyakaafdfavehqsverwqdmlafaaevtkneqmaellsgalapetlaesf
iavcgeqldengqnlirvmaengrlnalpdvleqfihlravseat
Timeline for d1abva_: