PDB entry 1abv

View 1abv on RCSB PDB site
Description: n-terminal domain of the delta subunit of the f1f0-ATP synthase from escherichia coli, nmr, minimized average structure
Class: ATP synthesis
Keywords: ATP synthesis, ATP synthase, f1-ATPase, delta subunit, nmr spectroscopy
Deposited on 1997-01-29, released 1997-07-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta subunit of the f1f0-ATP synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1abva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1abvA (A:)
sefitvarpyakaafdfavehqsverwqdmlafaaevtkneqmaellsgalapetlaesf
iavcgeqldengqnlirvmaengrlnalpdvleqfihlravseataevdvisaaalseqq
lakisaamekrlsr

    Sequence, based on observed residues (ATOM records): (download) 
    >1abvA (A:)
sefitvarpyakaafdfavehqsverwqdmlafaaevtkneqmaellsgalapetlaesf
iavcgeqldengqnlirvmaengrlnalpdvleqfihlravseat