SCOPe 2.07: Domain d3ol7a_: 3ol7 A:

Lineage for d3ol7a_ (3ol7 A:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)

6. Protein Viral RNA polymerase [56695] (17 species)

7. Species Poliovirus type 1, strain Mahoney [TaxId:12080] [56696] (12 PDB entries)
   Uniprot P03300 1748-2208

8. Domain d3ol7a_: 3ol7 A: [183114]
   automated match to d1ra6a_
   protein/RNA complex; complexed with gol, ipa, mg, peg, pop, zn

Details for d3ol7a_

PDB Entry: 3ol7, 2.7 Å

PDB Description: poliovirus polymerase elongation complex with ctp

PDB Compounds: (A:) Polymerase

SCOPe Domain Sequences for d3ol7a_:

Sequence; same for both SEQRES and ATOM records:

>d3ol7a_ e.8.1.4 (A:) Viral RNA polymerase {Poliovirus type 1, strain Mahoney [TaxId: 12080]}
geiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeeaifs
kyvgnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsagypy
vamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlieass
lndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgydas
lspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgcsgtsifnsmi
nnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpadks
atfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrslcll
awhngeeeynkflakirsvpigraldlpeystlyrrwldsf

Timeline for d3ol7a_:

• d3ol7a_ first appeared in SCOPe 2.01
  
• d3ol7a_ appears in SCOPe 2.06
  
• d3ol7a_ appears in the current release, SCOPe 2.08