Lineage for d3okia_ (3oki A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1097039Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1097040Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1097041Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1097817Protein automated matches [190059] (12 species)
    not a true protein
  7. 1097846Species Human (Homo sapiens) [TaxId:9606] [187214] (102 PDB entries)
  8. 1097907Domain d3okia_: 3oki A: [183075]
    automated match to d1osha_
    protein/DNA complex; complexed with oki

Details for d3okia_

PDB Entry: 3oki (more details), 2 Å

PDB Description: Crystal structure of human FXR in complex with (2S)-2-[2-(4-chlorophenyl)-1H-benzimidazol-1-yl]-N,2-dicyclohexylethanamide
PDB Compounds: (A:) Bile acid receptor

SCOPe Domain Sequences for d3okia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3okia_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meltpdqqtllhfimdsynkqrmpqeitnkilkeafsaeenfliltematnhvqvlveft
kklpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdllearirnsgisdeyi
tpmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckih
qpenpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq

SCOPe Domain Coordinates for d3okia_:

Click to download the PDB-style file with coordinates for d3okia_.
(The format of our PDB-style files is described here.)

Timeline for d3okia_: