Lineage for d3ohvb_ (3ohv B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903244Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1903245Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1903467Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 1903468Protein automated matches [190710] (3 species)
    not a true protein
  7. 1903469Species Human (Homo sapiens) [TaxId:9606] [187857] (25 PDB entries)
  8. 1903497Domain d3ohvb_: 3ohv B: [183042]
    automated match to d1r28a_

Details for d3ohvb_

PDB Entry: 3ohv (more details), 2.2 Å

PDB Description: Crystal structure of the human Bach2 POZ domain, form II
PDB Compounds: (B:) Transcription regulator protein BACH2

SCOPe Domain Sequences for d3ohvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ohvb_ d.42.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spmyvyestvhctnillglndqrkkdilcdvtliverkefrahravlaacseyfwqalvg
qtkndlvvslpeevtargfgpllqfaytaklllsrenirevircaeflrmhnledscfsf
l

SCOPe Domain Coordinates for d3ohvb_:

Click to download the PDB-style file with coordinates for d3ohvb_.
(The format of our PDB-style files is described here.)

Timeline for d3ohvb_: