Lineage for d1r28a_ (1r28 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903244Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1903245Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1903246Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 1903247Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)
  7. 1903248Species Human (Homo sapiens) [TaxId:9606] [102923] (7 PDB entries)
  8. 1903250Domain d1r28a_: 1r28 A: [96854]

Details for d1r28a_

PDB Entry: 1r28 (more details), 2.2 Å

PDB Description: crystal structure of the b-cell lymphoma 6 (bcl6) btb domain to 2.2 angstrom
PDB Compounds: (A:) B-cell lymphoma 6 protein

SCOPe Domain Sequences for d1r28a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r28a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
sqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk
rnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfik
as

SCOPe Domain Coordinates for d1r28a_:

Click to download the PDB-style file with coordinates for d1r28a_.
(The format of our PDB-style files is described here.)

Timeline for d1r28a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1r28b_