SCOPe 2.01: Domain d3obxa_: 3obx A:

Lineage for d3obxa_ (3obx A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.2: UEV domain [75383] (3 proteins)

6. Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75385] (11 PDB entries)

8. Domain d3obxa_: 3obx A: [182924]
   automated match to d1kppa_
   mutant

Details for d3obxa_

PDB Entry: 3obx, 1.6 Å

PDB Description: Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 Gag P7A mutant peptide

PDB Compounds: (A:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d3obxa_:

Sequence; same for both SEQRES and ATOM records:

>d3obxa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
vsesqlkkmvskykyrdltvretvnvitlykdlkpvldsygtgsrelmnltgtipvpyrg
ntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqsdll
gliqvmivvfgdeppvfsrp

Timeline for d3obxa_:

• d3obxa_ is new in SCOPe 2.01-stable
  
• d3obxa_ appears in SCOPe 2.02
  
• d3obxa_ appears in the current release, SCOPe 2.08