![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.2: UEV domain [75383] (3 proteins) |
![]() | Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75385] (11 PDB entries) |
![]() | Domain d3obxa_: 3obx A: [182924] automated match to d1kppa_ mutant |
PDB Entry: 3obx (more details), 1.6 Å
SCOPe Domain Sequences for d3obxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3obxa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} vsesqlkkmvskykyrdltvretvnvitlykdlkpvldsygtgsrelmnltgtipvpyrg ntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqsdll gliqvmivvfgdeppvfsrp
Timeline for d3obxa_: