Lineage for d1kppa_ (1kpp A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1021591Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1021592Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1021806Family d.20.1.2: UEV domain [75383] (3 proteins)
  6. 1021807Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)
  7. 1021808Species Human (Homo sapiens) [TaxId:9606] [75385] (11 PDB entries)
  8. 1021819Domain d1kppa_: 1kpp A: [72846]

Details for d1kppa_

PDB Entry: 1kpp (more details)

PDB Description: structure of the tsg101 uev domain
PDB Compounds: (A:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d1kppa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kppa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
avsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipv
pyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpq
sdllgliqvmivvfgdeppvfsrp

SCOPe Domain Coordinates for d1kppa_:

Click to download the PDB-style file with coordinates for d1kppa_.
(The format of our PDB-style files is described here.)

Timeline for d1kppa_: