Lineage for d1kppa_ (1kpp A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164133Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2164134Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2164459Family d.20.1.2: UEV domain [75383] (3 protein domains)
  6. 2164460Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)
  7. 2164461Species Human (Homo sapiens) [TaxId:9606] [75385] (13 PDB entries)
  8. 2164472Domain d1kppa_: 1kpp A: [72846]

Details for d1kppa_

PDB Entry: 1kpp (more details)

PDB Description: Structure of the Tsg101 UEV domain
PDB Compounds: (A:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d1kppa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kppa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
avsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipv
pyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpq
sdllgliqvmivvfgdeppvfsrp

SCOPe Domain Coordinates for d1kppa_:

Click to download the PDB-style file with coordinates for d1kppa_.
(The format of our PDB-style files is described here.)

Timeline for d1kppa_: