Lineage for d3o9ka_ (3o9k A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2074740Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2074741Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2075178Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2075179Protein automated matches [190692] (15 species)
    not a true protein
  7. 2075195Species Influenza a virus (a/duck/ukraine/1/1963(h3n8)) [TaxId:385580] [189572] (2 PDB entries)
  8. 2075197Domain d3o9ka_: 3o9k A: [182897]
    automated match to d2bata_
    complexed with ett

Details for d3o9ka_

PDB Entry: 3o9k (more details), 2.49 Å

PDB Description: influenza na in complex with compound 6
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d3o9ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o9ka_ b.68.1.0 (A:) automated matches {Influenza a virus (a/duck/ukraine/1/1963(h3n8)) [TaxId: 385580]}
tymnnteaicdakgfapfskdngirigsrghifvirepfvscspiecrtffltqgsllnd
khsngtvkdrspfrtlmsvevgqspnvyqarfeavawsatachdgkkwmtvgvtgpdska
vavihyggvptdvvnswagdilrtqessctciqgdcywvmtdgpanrqaqyriykanqgr
iigqtdisfngghieecscypndgkvecvcrdnwtgtnrpvlvispdlsyrvgylcagip
sdtprgedtqftgsctspmgnqgygvkgfgfrqgtdvwmgrtisrtsrsgfeilrikngw
tqtskeqirkqvvvdnlnwsgysgsftlpvelsgkdclvpcfwvemirgkpeektiwtss
ssivmcgvdyevadwswhdgailpfdi

SCOPe Domain Coordinates for d3o9ka_:

Click to download the PDB-style file with coordinates for d3o9ka_.
(The format of our PDB-style files is described here.)

Timeline for d3o9ka_: