SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3o9ka_ (3o9k A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2065391Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2065392Protein automated matches [190692] (14 species)
    not a true protein
  7. 2065406Species Influenza a virus (a/duck/ukraine/1/1963(h3n8)) [TaxId:385580] [189572] (2 PDB entries)
  8. 2065408Domain d3o9ka_: 3o9k A: [182897]
    automated match to d2bata_
    complexed with ett

Details for d3o9ka_

PDB Entry: 3o9k (more details), 2.49 Å

PDB Description: Influenza NA in complex with compound 6
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d3o9ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o9ka_ b.68.1.0 (A:) automated matches {Influenza a virus (a/duck/ukraine/1/1963(h3n8)) [TaxId: 385580]}
tymnnteaicdakgfapfskdngirigsrghifvirepfvscspiecrtffltqgsllnd
khsngtvkdrspfrtlmsvevgqspnvyqarfeavawsatachdgkkwmtvgvtgpdska
vavihyggvptdvvnswagdilrtqessctciqgdcywvmtdgpanrqaqyriykanqgr
iigqtdisfngghieecscypndgkvecvcrdnwtgtnrpvlvispdlsyrvgylcagip
sdtprgedtqftgsctspmgnqgygvkgfgfrqgtdvwmgrtisrtsrsgfeilrikngw
tqtskeqirkqvvvdnlnwsgysgsftlpvelsgkdclvpcfwvemirgkpeektiwtss
ssivmcgvdyevadwswhdgailpfdi

SCOPe Domain Coordinates for d3o9ka_:

Click to download the PDB-style file with coordinates for d3o9ka_.
(The format of our PDB-style files is described here.)

Timeline for d3o9ka_: