Lineage for d3o8ia_ (3o8i A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. Protein automated matches [190238] (5 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187008] (38 PDB entries)
  8. 1501412Domain d3o8ia_: 3o8i A: [182876]
    automated match to d1qjaa_
    complexed with m1t

Details for d3o8ia_

PDB Entry: 3o8i (more details), 2 Å

PDB Description: Structure of 14-3-3 isoform sigma in complex with a C-Raf1 peptide and a stabilizing small molecule fragment
PDB Compounds: (A:) 14-3-3 protein sigma

SCOPe Domain Sequences for d3o8ia_:

Sequence, based on SEQRES records: (download)

>d3o8ia_ a.118.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqra
awrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaesr
vfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfs
vfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

Sequence, based on observed residues (ATOM records): (download)

>d3o8ia_ a.118.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqra
awrvlssieqgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkmkgdy
yrylaevatkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyeianspeea
islakttfdeamadlhtlsykdstlimqllrdnltlwt

SCOPe Domain Coordinates for d3o8ia_:

Click to download the PDB-style file with coordinates for d3o8ia_.
(The format of our PDB-style files is described here.)

Timeline for d3o8ia_: