Lineage for d3o61a_ (3o61 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971495Protein ADP-ribose pyrophosphatase homologue YffH [103201] (1 species)
  7. 2971496Species Escherichia coli [TaxId:562] [103202] (5 PDB entries)
  8. 2971506Domain d3o61a_: 3o61 A: [182819]
    automated match to d1viua_
    complexed with cl, gdd, mg, na

    has additional subdomain(s) that are not in the common domain

Details for d3o61a_

PDB Entry: 3o61 (more details), 2.45 Å

PDB Description: Structure of the E100A E.coli GDP-mannose hydrolase (yffh) in complex with GDP-mannose and Mg++
PDB Compounds: (A:) GDP-mannose pyrophosphatase nudK

SCOPe Domain Sequences for d3o61a_:

Sequence, based on SEQRES records: (download)

>d3o61a_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]}
mtqqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkktv
vlirqfrvatwvngnesgqliescaglldndepevcirkaaieetgyevgevrklfelym
spggvtelihffiaeysdnqranagggvededievlelpfsqalemiktgeirdgktvll
lnylqtshlmd

Sequence, based on observed residues (ATOM records): (download)

>d3o61a_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]}
mtqqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkktv
vlirqfrvatwvngnesgqliescaglldndepevcirkaaieetgyevgevrklfelym
spggvtelihffiaeysdnqranaggedievlelpfsqalemiktgeirdgktvlllnyl
qtshlmd

SCOPe Domain Coordinates for d3o61a_:

Click to download the PDB-style file with coordinates for d3o61a_.
(The format of our PDB-style files is described here.)

Timeline for d3o61a_: