SCOPe 2.08: Domain d3o61d_: 3o61 D:

Lineage for d3o61d_ (3o61 D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein ADP-ribose pyrophosphatase homologue YffH [103201] (1 species)

7. Species Escherichia coli [TaxId:562] [103202] (5 PDB entries)

8. Domain d3o61d_: 3o61 D: [182822]
   automated match to d1viua_
   complexed with cl, gdd, mg, na
   has additional subdomain(s) that are not in the common domain

Details for d3o61d_

PDB Entry: 3o61, 2.45 Å

PDB Description: Structure of the E100A E.coli GDP-mannose hydrolase (yffh) in complex with GDP-mannose and Mg++

PDB Compounds: (D:) GDP-mannose pyrophosphatase nudK

SCOPe Domain Sequences for d3o61d_:

Sequence; same for both SEQRES and ATOM records:

>d3o61d_ d.113.1.1 (D:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]}
tqqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkktvv
lirqfrvatwvngnesgqliescaglldndepevcirkaaieetgyevgevrklfelyms
pggvtelihffiaeysdnqranagggvededievlelpfsqalemiktgeirdgktvlll
nylqtshlmd

Timeline for d3o61d_:

• d3o61d_ first appeared in SCOPe 2.01
  
• d3o61d_ appears in SCOPe 2.07