Class b: All beta proteins [48724] (174 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein automated matches [190055] (6 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [189198] (2 PDB entries) |
Domain d3o5ne_: 3o5n E: [182811] automated match to d1q3ob_ complexed with br0 |
PDB Entry: 3o5n (more details), 1.83 Å
SCOPe Domain Sequences for d3o5ne_:
Sequence, based on SEQRES records: (download)
>d3o5ne_ b.36.1.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} sdyviddkvailqkrdhegfgfvlrgakaetpieeftptpafpalqylesvdvegvawra glrtgdflievngvnvvkvghkqvvglirqggnrlvmkvvsvtrk
>d3o5ne_ b.36.1.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} sdyviddkvailqkrdhegfgfvlptpafpalqylesvdvegvawraglrtgdflievng vnvvkvghkqvvglirqggnrlvmkvvsvtrk
Timeline for d3o5ne_: