Lineage for d3o5ne_ (3o5n E:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1122537Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1122538Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1122539Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1122830Protein automated matches [190055] (6 species)
    not a true protein
  7. 1122868Species Mouse (Mus musculus) [TaxId:10090] [189198] (2 PDB entries)
  8. 1122874Domain d3o5ne_: 3o5n E: [182811]
    automated match to d1q3ob_
    complexed with br0

Details for d3o5ne_

PDB Entry: 3o5n (more details), 1.83 Å

PDB Description: Tetrahydroquinoline carboxylates are potent inhibitors of the Shank PDZ domain, a putative target in autism disorders
PDB Compounds: (E:) SH3 and multiple ankyrin repeat domains protein 3

SCOPe Domain Sequences for d3o5ne_:

Sequence, based on SEQRES records: (download)

>d3o5ne_ b.36.1.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sdyviddkvailqkrdhegfgfvlrgakaetpieeftptpafpalqylesvdvegvawra
glrtgdflievngvnvvkvghkqvvglirqggnrlvmkvvsvtrk

Sequence, based on observed residues (ATOM records): (download)

>d3o5ne_ b.36.1.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sdyviddkvailqkrdhegfgfvlptpafpalqylesvdvegvawraglrtgdflievng
vnvvkvghkqvvglirqggnrlvmkvvsvtrk

SCOPe Domain Coordinates for d3o5ne_:

Click to download the PDB-style file with coordinates for d3o5ne_.
(The format of our PDB-style files is described here.)

Timeline for d3o5ne_: