SCOPe 2.03: Domain d3o2cb_: 3o2c B:

Lineage for d3o2cb_ (3o2c B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Phycocyanin beta subunit [88940] (8 species)

7. Species Synechococcus vulcanus [TaxId:32053] [88944] (6 PDB entries)

8. Domain d3o2cb_: 3o2c B: [182753]
   Other proteins in same PDB: d3o2ca_
   automated match to d1i7yb_
   complexed with cyc

Details for d3o2cb_

PDB Entry: 3o2c, 1.5 Å

PDB Description: Crystal structure of a rod form of c-phycocyanin from Themosynechococcus vulcanus at 1.5 angstroms

PDB Compounds: (B:) c-phycocyanin beta subunit

SCOPe Domain Sequences for d3o2cb_:

Sequence; same for both SEQRES and ATOM records:

>d3o2cb_ a.1.1.3 (B:) Phycocyanin beta subunit {Synechococcus vulcanus [TaxId: 32053]}
mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava

Timeline for d3o2cb_:

• d3o2cb_ first appeared in SCOPe 2.01
  
• d3o2cb_ appears in SCOPe 2.02
  
• d3o2cb_ appears in SCOPe 2.04
  
• d3o2cb_ appears in the current release, SCOPe 2.08