Lineage for d3o2ca_ (3o2c A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1255931Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1255956Protein Phycocyanin alpha subunit [88933] (8 species)
  7. 1256006Species Synechococcus vulcanus [TaxId:32053] [88938] (7 PDB entries)
  8. 1256008Domain d3o2ca_: 3o2c A: [182752]
    Other proteins in same PDB: d3o2cb_
    automated match to d1i7ya_
    complexed with cyc

Details for d3o2ca_

PDB Entry: 3o2c (more details), 1.5 Å

PDB Description: Crystal structure of a rod form of c-phycocyanin from Themosynechococcus vulcanus at 1.5 angstroms
PDB Compounds: (A:) c-phycocyanin alpha subunit

SCOPe Domain Sequences for d3o2ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o2ca_ a.1.1.3 (A:) Phycocyanin alpha subunit {Synechococcus vulcanus [TaxId: 32053]}
mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
qkfpytttmqgsqyastpegkakcardigyylrmityclvaggtgpmdeyliaglseins
tfdlspswyiealkyikanhgltgqaaveanayidyainals

SCOPe Domain Coordinates for d3o2ca_:

Click to download the PDB-style file with coordinates for d3o2ca_.
(The format of our PDB-style files is described here.)

Timeline for d3o2ca_: