Class a: All alpha proteins [46456] (151 folds) |
Fold a.69: Left-handed superhelix [47916] (3 superfamilies) |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) |
Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein) |
Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [47920] (9 PDB entries) |
Domain d1e79d1: 1e79 D:358-475 [18272] Other proteins in same PDB: d1e79a2, d1e79a3, d1e79b2, d1e79b3, d1e79c2, d1e79c3, d1e79d2, d1e79d3, d1e79e2, d1e79e3, d1e79f2, d1e79f3, d1e79g_, d1e79h1, d1e79h2, d1e79i_ |
PDB Entry: 1e79 (more details), 2.4 Å
SCOP Domain Sequences for d1e79d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e79d1 a.69.1.1 (D:358-475) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)} mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadklae
Timeline for d1e79d1: