Lineage for d1e79b2 (1e79 B:19-94)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 168781Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
  4. 168782Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 168783Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)
  6. 168784Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species)
  7. 168788Species Cow (Bos taurus) [TaxId:9913] [50618] (9 PDB entries)
  8. 168790Domain d1e79b2: 1e79 B:19-94 [26435]
    Other proteins in same PDB: d1e79a1, d1e79a3, d1e79b1, d1e79b3, d1e79c1, d1e79c3, d1e79d1, d1e79d3, d1e79e1, d1e79e3, d1e79f1, d1e79f3, d1e79g_, d1e79h1, d1e79h2, d1e79i_

Details for d1e79b2

PDB Entry: 1e79 (more details), 2.4 Å

PDB Description: Bovine F1-ATPase inhibited by DCCD (dicyclohexylcarbodiimide)

SCOP Domain Sequences for d1e79b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e79b2 b.49.1.1 (B:19-94) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
adtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgn
dklikegdivkrtgai

SCOP Domain Coordinates for d1e79b2:

Click to download the PDB-style file with coordinates for d1e79b2.
(The format of our PDB-style files is described here.)

Timeline for d1e79b2: