Lineage for d1e79b1 (1e79 B:380-510)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717310Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 2717311Protein F1 ATP synthase alpha subunit, domain 3 [88886] (5 species)
  7. 2717330Species Cow (Bos taurus) [TaxId:9913] [88893] (15 PDB entries)
    Uniprot P19483
  8. 2717344Domain d1e79b1: 1e79 B:380-510 [18270]
    Other proteins in same PDB: d1e79a2, d1e79a3, d1e79b2, d1e79b3, d1e79c2, d1e79c3, d1e79d1, d1e79d2, d1e79d3, d1e79e1, d1e79e2, d1e79e3, d1e79f1, d1e79f2, d1e79f3, d1e79g_, d1e79h1, d1e79h2, d1e79i_
    complexed with adp, atp, dcw, gol, mg, so4

Details for d1e79b1

PDB Entry: 1e79 (more details), 2.4 Å

PDB Description: Bovine F1-ATPase inhibited by DCCD (dicyclohexylcarbodiimide)
PDB Compounds: (B:) ATP synthase alpha chain heart isoform

SCOPe Domain Sequences for d1e79b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e79b1 a.69.1.1 (B:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

SCOPe Domain Coordinates for d1e79b1:

Click to download the PDB-style file with coordinates for d1e79b1.
(The format of our PDB-style files is described here.)

Timeline for d1e79b1: