Lineage for d1e79g_ (1e79 G:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120383Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 2120543Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 2120544Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein)
    automatically mapped to Pfam PF00231
  6. 2120545Protein F1 ATP synthase gamma subunit [52945] (4 species)
  7. 2120560Species Cow (Bos taurus) [TaxId:9913] [52946] (19 PDB entries)
    Uniprot P05631
  8. 2120572Domain d1e79g_: 1e79 G: [33158]
    Other proteins in same PDB: d1e79a1, d1e79a2, d1e79a3, d1e79b1, d1e79b2, d1e79b3, d1e79c1, d1e79c2, d1e79c3, d1e79d1, d1e79d2, d1e79d3, d1e79e1, d1e79e2, d1e79e3, d1e79f1, d1e79f2, d1e79f3, d1e79h1, d1e79h2, d1e79i_
    complexed with adp, atp, dcw, gol, mg, so4

Details for d1e79g_

PDB Entry: 1e79 (more details), 2.4 Å

PDB Description: Bovine F1-ATPase inhibited by DCCD (dicyclohexylcarbodiimide)
PDB Compounds: (G:) ATP synthase gamma chain

SCOPe Domain Sequences for d1e79g_:

Sequence, based on SEQRES records: (download)

>d1e79g_ c.49.2.1 (G:) F1 ATP synthase gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaaal

Sequence, based on observed residues (ATOM records): (download)

>d1e79g_ c.49.2.1 (G:) F1 ATP synthase gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
eliigvssdrglcgaihssvakqmkseaanlkevkiigvgdkirsilhrthsdqflvtfk
evgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifsldtissaes
msiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknasemidkltlt
fnrtrqavitkelieiisgaaal

SCOPe Domain Coordinates for d1e79g_:

Click to download the PDB-style file with coordinates for d1e79g_.
(The format of our PDB-style files is described here.)

Timeline for d1e79g_: