Lineage for d3nzeb1 (3nze B:56-316)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922594Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2922595Protein automated matches [191112] (17 species)
    not a true protein
  7. 2922662Species Arthrobacter aurescens [TaxId:290340] [189428] (1 PDB entry)
  8. 2922664Domain d3nzeb1: 3nze B:56-316 [182658]
    Other proteins in same PDB: d3nzea2, d3nzeb2
    automated match to d2gnpa1
    complexed with ca

Details for d3nzeb1

PDB Entry: 3nze (more details), 1.7 Å

PDB Description: The crystal structure of a domain of a possible sugar-binding transcriptional regulator from Arthrobacter aurescens TC1.
PDB Compounds: (B:) Putative transcriptional regulator, sugar-binding family

SCOPe Domain Sequences for d3nzeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nzeb1 c.124.1.0 (B:56-316) automated matches {Arthrobacter aurescens [TaxId: 290340]}
spfdtgpelesqirnqygvdvhvvpvldtlneaetldrvamqaartigplvdsnaiigva
wgatlsavsrhltrkmthdsivvqlngagnmqttgityasdimrrfgsaygarveqfpvp
affdhastktamwnersvqrildlqarmsiaifgvgsvdsdypshvyaggyldehdltml
aaddvvgdvatvffrsdgssdgitlnerstgpsheqlrqvrrricvvsgaskinglqgal
aaglatdlildeasarrlvsf

SCOPe Domain Coordinates for d3nzeb1:

Click to download the PDB-style file with coordinates for d3nzeb1.
(The format of our PDB-style files is described here.)

Timeline for d3nzeb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nzeb2