PDB entry 3nze

View 3nze on RCSB PDB site
Description: The crystal structure of a domain of a possible sugar-binding transcriptional regulator from Arthrobacter aurescens TC1.
Class: Transcription regulator
Keywords: structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, Transcription regulator
Deposited on 2010-07-16, released 2010-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.17
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative transcriptional regulator, sugar-binding family
    Species: Arthrobacter aurescens [TaxId:290340]
    Gene: AAur_2250
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1R6X9 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d3nzea1, d3nzea2
  • Chain 'B':
    Compound: Putative transcriptional regulator, sugar-binding family
    Species: Arthrobacter aurescens [TaxId:290340]
    Gene: AAur_2250
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1R6X9 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d3nzeb1, d3nzeb2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nzeA (A:)
    snaspfdtgpelesqirnqygvdvhvvpvldtlneaetldrvamqaartigplvdsnaii
    gvawgatlsavsrhltrkmthdsivvqlngagnmqttgityasdimrrfgsaygarveqf
    pvpaffdhastktamwnersvqrildlqarmsiaifgvgsvdsdypshvyaggyldehdl
    tmlaaddvvgdvatvffrsdgssdgitlnerstgpsheqlrqvrrricvvsgaskinglq
    galaaglatdlildeasarrlvsfngh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nzeA (A:)
    aspfdtgpelesqirnqygvdvhvvpvldtlneaetldrvamqaartigplvdsnaiigv
    awgatlsavsrhltrkmthdsivvqlngagnmqttgityasdimrrfgsaygarveqfpv
    paffdhastktamwnersvqrildlqarmsiaifgvgsvdhvyaggyldehdltmlaadd
    vvgdvatvffrsdgssdgitlnerstgpsheqlrqvrrricvvsgaskinglqgalaagl
    atdlildeasarrlvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nzeB (B:)
    snaspfdtgpelesqirnqygvdvhvvpvldtlneaetldrvamqaartigplvdsnaii
    gvawgatlsavsrhltrkmthdsivvqlngagnmqttgityasdimrrfgsaygarveqf
    pvpaffdhastktamwnersvqrildlqarmsiaifgvgsvdsdypshvyaggyldehdl
    tmlaaddvvgdvatvffrsdgssdgitlnerstgpsheqlrqvrrricvvsgaskinglq
    galaaglatdlildeasarrlvsfngh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nzeB (B:)
    aspfdtgpelesqirnqygvdvhvvpvldtlneaetldrvamqaartigplvdsnaiigv
    awgatlsavsrhltrkmthdsivvqlngagnmqttgityasdimrrfgsaygarveqfpv
    paffdhastktamwnersvqrildlqarmsiaifgvgsvdsdypshvyaggyldehdltm
    laaddvvgdvatvffrsdgssdgitlnerstgpsheqlrqvrrricvvsgaskinglqga
    laaglatdlildeasarrlvsf