Lineage for d3ny7b_ (3ny7 B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1086307Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1086308Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1086309Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 1086363Protein automated matches [190286] (5 species)
    not a true protein
  7. 1086369Species Escherichia coli [TaxId:562] [187089] (2 PDB entries)
  8. 1086372Domain d3ny7b_: 3ny7 B: [182625]
    automated match to d1acpa_
    complexed with gol, sxm

Details for d3ny7b_

PDB Entry: 3ny7 (more details), 1.92 Å

PDB Description: STAS domain of YchM bound to ACP
PDB Compounds: (B:) Acyl carrier protein

SCOPe Domain Sequences for d3ny7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ny7b_ a.28.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyinghqa

SCOPe Domain Coordinates for d3ny7b_:

Click to download the PDB-style file with coordinates for d3ny7b_.
(The format of our PDB-style files is described here.)

Timeline for d3ny7b_: