| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
| Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
| Protein automated matches [190286] (9 species) not a true protein |
| Species Escherichia coli [TaxId:562] [187089] (2 PDB entries) |
| Domain d3ny7b_: 3ny7 B: [182625] automated match to d1acpa_ complexed with gol, sxm |
PDB Entry: 3ny7 (more details), 1.92 Å
SCOPe Domain Sequences for d3ny7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ny7b_ a.28.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyinghqa
Timeline for d3ny7b_: