Lineage for d3ntwa_ (3ntw A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 926441Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 926442Superfamily a.144.1: PABC (PABP) domain [63570] (1 family) (S)
  5. 926443Family a.144.1.1: PABC (PABP) domain [63571] (3 proteins)
  6. 926456Protein automated matches [191271] (1 species)
    not a true protein
  7. 926457Species Norway rat (Rattus norvegicus) [TaxId:10116] [189851] (1 PDB entry)
  8. 926458Domain d3ntwa_: 3ntw A: [182537]
    automated match to d1i2ta_

Details for d3ntwa_

PDB Entry: 3ntw (more details), 2.6 Å

PDB Description: structure of the mlle domain of edd in complex with a pam2 peptide from paip1
PDB Compounds: (A:) E3 ubiquitin-protein ligase UBR5

SCOPe Domain Sequences for d3ntwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ntwa_ a.144.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gshrqalgerlyprvqamqpafaskitgmllelspaqlllllasedslrarveeameliv
a

SCOPe Domain Coordinates for d3ntwa_:

Click to download the PDB-style file with coordinates for d3ntwa_.
(The format of our PDB-style files is described here.)

Timeline for d3ntwa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ntwc_