SCOPe 2.08: Domain d3ntwa1: 3ntw A:2379-2437

Lineage for d3ntwa1 (3ntw A:2379-2437)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.144: PABP domain-like [63569] (2 superfamilies)
   4 helices; an orthogonal array

4. Superfamily a.144.1: PABC (PABP) domain [63570] (2 families)

5. Family a.144.1.1: PABC (PABP) domain [63571] (3 proteins)

6. Protein automated matches [191271] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [189851] (1 PDB entry)

8. Domain d3ntwa1: 3ntw A:2379-2437 [182537]
   Other proteins in same PDB: d3ntwa2
   automated match to d1i2ta_

Details for d3ntwa1

PDB Entry: 3ntw, 2.6 Å

PDB Description: structure of the mlle domain of edd in complex with a pam2 peptide from paip1

PDB Compounds: (A:) E3 ubiquitin-protein ligase UBR5

SCOPe Domain Sequences for d3ntwa1:

Sequence; same for both SEQRES and ATOM records:

>d3ntwa1 a.144.1.1 (A:2379-2437) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hrqalgerlyprvqamqpafaskitgmllelspaqlllllasedslrarveeameliva

Timeline for d3ntwa1:

• d3ntwa1 first appeared in SCOPe 2.01, called d3ntwa_
  
• d3ntwa1 appears in SCOPe 2.07