Class a: All alpha proteins [46456] (290 folds) |
Fold a.144: PABP domain-like [63569] (2 superfamilies) 4 helices; an orthogonal array |
Superfamily a.144.1: PABC (PABP) domain [63570] (2 families) |
Family a.144.1.1: PABC (PABP) domain [63571] (3 proteins) |
Protein automated matches [191271] (2 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [189851] (1 PDB entry) |
Domain d3ntwa1: 3ntw A:2379-2437 [182537] Other proteins in same PDB: d3ntwa2 automated match to d1i2ta_ |
PDB Entry: 3ntw (more details), 2.6 Å
SCOPe Domain Sequences for d3ntwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ntwa1 a.144.1.1 (A:2379-2437) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} hrqalgerlyprvqamqpafaskitgmllelspaqlllllasedslrarveeameliva
Timeline for d3ntwa1: