SCOPe 2.07: Domain d3nhla_: 3nhl A:

Lineage for d3nhla_ (3nhl A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.3: Quinone reductase [52235] (4 proteins)
   binds FAD

6. Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52241] (66 PDB entries)

8. Domain d3nhla_: 3nhl A: [182296]
   automated match to d1qr2a_
   complexed with fad, ytr, zn

Details for d3nhla_

PDB Entry: 3nhl, 1.57 Å

PDB Description: x-ray crystallographic structure activity relationship (sar) of casimiroin and its analogs bound to human quinone reductase 2

PDB Compounds: (A:) Ribosyldihydronicotinamide dehydrogenase [quinone]

SCOPe Domain Sequences for d3nhla_:

Sequence; same for both SEQRES and ATOM records:

>d3nhla_ c.23.5.3 (A:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq

Timeline for d3nhla_:

• d3nhla_ first appeared in SCOPe 2.01
  
• d3nhla_ appears in SCOPe 2.06
  
• d3nhla_ appears in the current release, SCOPe 2.08