Lineage for d1qr2a_ (1qr2 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2464623Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2464786Family c.23.5.3: Quinone reductase [52235] (4 proteins)
    binds FAD
  6. 2464854Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species)
  7. 2464855Species Human (Homo sapiens) [TaxId:9606] [52241] (66 PDB entries)
  8. 2464929Domain d1qr2a_: 1qr2 A: [31231]
    complexed with fad, zn

Details for d1qr2a_

PDB Entry: 1qr2 (more details), 2.1 Å

PDB Description: human quinone reductase type 2
PDB Compounds: (A:) protein (quinone reductase type 2)

SCOPe Domain Sequences for d1qr2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qr2a_ c.23.5.3 (A:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq

SCOPe Domain Coordinates for d1qr2a_:

Click to download the PDB-style file with coordinates for d1qr2a_.
(The format of our PDB-style files is described here.)

Timeline for d1qr2a_: