Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily) beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4) |
Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) |
Family d.120.1.1: Cytochrome b5 [55857] (5 proteins) |
Protein automated matches [190702] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189965] (1 PDB entry) |
Domain d3nerb_: 3ner B: [182200] automated match to d1b5ma_ complexed with hem, mg, so4 |
PDB Entry: 3ner (more details), 1.45 Å
SCOPe Domain Sequences for d3nerb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nerb_ d.120.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kgqevetsvtyyrleevakrnslkelwlvihgrvydvtrflnehpggeevlleqagvdas esfedvghssdaremlkqyyigdihpsdlkp
Timeline for d3nerb_: