SCOPe 2.08: Domain d3nerb_: 3ner B:

Lineage for d3nerb_ (3ner B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
   beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)

4. Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families)

5. Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)

6. Protein automated matches [190702] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189965] (2 PDB entries)

8. Domain d3nerb_: 3ner B: [182200]
   automated match to d1b5ma_
   complexed with hem, mg, so4

Details for d3nerb_

PDB Entry: 3ner, 1.45 Å

PDB Description: Structure of Human Type B Cytochrome b5

PDB Compounds: (B:) Cytochrome b5 type B

SCOPe Domain Sequences for d3nerb_:

Sequence; same for both SEQRES and ATOM records:

>d3nerb_ d.120.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgqevetsvtyyrleevakrnslkelwlvihgrvydvtrflnehpggeevlleqagvdas
esfedvghssdaremlkqyyigdihpsdlkp

Timeline for d3nerb_:

• d3nerb_ first appeared in SCOPe 2.01
  
• d3nerb_ appears in SCOPe 2.07