Lineage for d1fqjd1 (1fqj D:61-181)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 49041Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
  4. 49042Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
  5. 49043Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 49044Protein Transducin (alpha subunit), insertion domain [47897] (2 species)
  7. 49062Species Rat (Rattus norvegicus) [TaxId:10116] [47899] (17 PDB entries)
  8. 49080Domain d1fqjd1: 1fqj D:61-181 [18216]
    Other proteins in same PDB: d1fqja2, d1fqjb_, d1fqjc_, d1fqjd2, d1fqje_

Details for d1fqjd1

PDB Entry: 1fqj (more details), 2.02 Å

PDB Description: crystal structure of the heterotrimeric complex of the rgs domain of rgs9, the gamma subunit of phosphodiesterase and the gt/i1 chimera alpha subunit [(rgs9)-(pdegamma)-(gt/i1alpha)-(gdp)-(alf4-)-(mg2+)]

SCOP Domain Sequences for d1fqjd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fqjd1 a.66.1.1 (D:61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus)}
eclefiaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmpkems
diiqrlwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvkttgi
i

SCOP Domain Coordinates for d1fqjd1:

Click to download the PDB-style file with coordinates for d1fqjd1.
(The format of our PDB-style files is described here.)

Timeline for d1fqjd1: