Lineage for d1fqjd2 (1fqj D:28-60,D:182-342)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69650Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 69860Protein Transducin (alpha subunit) [52623] (2 species)
  7. 69878Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (17 PDB entries)
  8. 69896Domain d1fqjd2: 1fqj D:28-60,D:182-342 [32099]
    Other proteins in same PDB: d1fqja1, d1fqjb_, d1fqjc_, d1fqjd1, d1fqje_

Details for d1fqjd2

PDB Entry: 1fqj (more details), 2.02 Å

PDB Description: crystal structure of the heterotrimeric complex of the rgs domain of rgs9, the gamma subunit of phosphodiesterase and the gt/i1 chimera alpha subunit [(rgs9)-(pdegamma)-(gt/i1alpha)-(gdp)-(alf4-)-(mg2+)]

SCOP Domain Sequences for d1fqjd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fqjd2 c.37.1.8 (D:28-60,D:182-342) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
rtvkllllgagesgkstivkqmkiihqdgysleXetqfsfkdlnfrmfdvggqrserkkw
ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
dlfeekikksplticypeyagsntyeeagnyikvqflelnmrrdvkeiyshmtcatdtqn
vkfvfdavtdiiike

SCOP Domain Coordinates for d1fqjd2:

Click to download the PDB-style file with coordinates for d1fqjd2.
(The format of our PDB-style files is described here.)

Timeline for d1fqjd2: