SCOPe 2.01: Domain d3na1d_: 3na1 D:

Lineage for d3na1d_ (3na1 D:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein automated matches [190231] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189528] (4 PDB entries)

8. Domain d3na1d_: 3na1 D: [182112]
   automated match to d1e6eb_
   complexed with fes, hcd, hem

Details for d3na1d_

PDB Entry: 3na1, 2.25 Å

PDB Description: crystal structure of human cyp11a1 in complex with 20- hydroxycholesterol

PDB Compounds: (D:) Adrenodoxin, mitochondrial

SCOPe Domain Sequences for d3na1d_:

Sequence, based on SEQRES records:

>d3na1d_ d.15.4.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
acegtlacstchlifedhiyekldaitdeendmldlaygltdrsrlgcq

Sequence, based on observed residues (ATOM records):

>d3na1d_ d.15.4.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
acegtlacstceendmldlalgcq

Timeline for d3na1d_:

• d3na1d_ is new in SCOPe 2.01-stable
  
• d3na1d_ appears in SCOPe 2.02
  
• d3na1d_ appears in the current release, SCOPe 2.08