![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
![]() | Protein automated matches [190231] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189528] (5 PDB entries) |
![]() | Domain d3na1d_: 3na1 D: [182112] Other proteins in same PDB: d3na1a_, d3na1b_ automated match to d1e6eb_ complexed with fes, hcd, hem fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 3na1 (more details), 2.25 Å
SCOPe Domain Sequences for d3na1d_:
Sequence, based on SEQRES records: (download)
>d3na1d_ d.15.4.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} acegtlacstchlifedhiyekldaitdeendmldlaygltdrsrlgcq
>d3na1d_ d.15.4.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} acegtlacstceendmldlalgcq
Timeline for d3na1d_: