Lineage for d1cjtc1 (1cjt C:86-201)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1494816Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 1494817Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 1494818Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 1494819Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 1494820Species Cow (Bos taurus) [TaxId:9913] [47898] (18 PDB entries)
  8. 1494833Domain d1cjtc1: 1cjt C:86-201 [18206]
    Other proteins in same PDB: d1cjta_, d1cjtb_, d1cjtc2
    complexed with cl, dad, fok, gsp, mes, mg, mn

Details for d1cjtc1

PDB Entry: 1cjt (more details), 2.8 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp, mn, and mg
PDB Compounds: (C:) guanine nucleotide-binding protein g(s)

SCOPe Domain Sequences for d1cjtc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjtc1 a.66.1.1 (C:86-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
gekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppe
fyehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr

SCOPe Domain Coordinates for d1cjtc1:

Click to download the PDB-style file with coordinates for d1cjtc1.
(The format of our PDB-style files is described here.)

Timeline for d1cjtc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cjtc2