| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) ![]() this domain interrupts the G-protein common fold |
| Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
| Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
| Species Cow (Bos taurus) [TaxId:9913] [47898] (18 PDB entries) |
| Domain d1cjtc1: 1cjt C:86-201 [18206] Other proteins in same PDB: d1cjta_, d1cjtb_, d1cjtc2 complexed with cl, dad, fok, gsp, mes, mg, mn |
PDB Entry: 1cjt (more details), 2.8 Å
SCOPe Domain Sequences for d1cjtc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cjtc1 a.66.1.1 (C:86-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
gekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppe
fyehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr
Timeline for d1cjtc1: