SCOP 1.61: Domain d1azsc1: 1azs C:86-201

Lineage for d1azsc1 (1azs C:86-201)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47898] (11 PDB entries)

8. Domain d1azsc1: 1azs C:86-201 [18203]
   Other proteins in same PDB: d1azsa_, d1azsb_, d1azsc2

Details for d1azsc1

PDB Entry: 1azs, 2.3 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase

SCOP Domain Sequences for d1azsc1:

Sequence; same for both SEQRES and ATOM records:

>d1azsc1 a.66.1.1 (C:86-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus)}
gekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppe
fyehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr

Timeline for d1azsc1:

• d1azsc1 first appeared (with stable ids) in SCOP 1.55
  
• d1azsc1 appears in SCOP 1.59
  
• d1azsc1 appears in SCOP 1.63
  
• d1azsc1 appears in the current release, SCOPe 2.08