Lineage for d3n0cb_ (3n0c B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1685571Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
    complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354
  4. 1685572Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (1 family) (S)
    automatically mapped to Pfam PF02511
  5. 1685573Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins)
  6. 1685574Protein Thy1 homologue [69798] (1 species)
  7. 1685575Species Thermotoga maritima [TaxId:2336] [69799] (22 PDB entries)
    TM0449
  8. 1685629Domain d3n0cb_: 3n0c B: [181748]
    automated match to d1kq4b_
    complexed with fad, ump; mutant

Details for d3n0cb_

PDB Entry: 3n0c (more details), 2.3 Å

PDB Description: tm0449 mutant crystal grown by hanging drop method
PDB Compounds: (B:) Thymidylate synthase thyX

SCOPe Domain Sequences for d3n0cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n0cb_ d.207.1.1 (B:) Thy1 homologue {Thermotoga maritima [TaxId: 2336]}
mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfehi
vftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervte
kiseivdkayrtyleliesgvprevarivlplnlytrafatvnarslmnflnlradshaq
weiqqyalaiarifkekcpwtfeaflkyaykgdilkevqv

SCOPe Domain Coordinates for d3n0cb_:

Click to download the PDB-style file with coordinates for d3n0cb_.
(The format of our PDB-style files is described here.)

Timeline for d3n0cb_: