Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily) complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354 |
Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (2 families) automatically mapped to Pfam PF02511 |
Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins) |
Protein Thy1 homologue [69798] (1 species) |
Species Thermotoga maritima [TaxId:2336] [69799] (29 PDB entries) TM0449 |
Domain d3n0cb_: 3n0c B: [181748] Other proteins in same PDB: d3n0ca2 automated match to d1kq4b_ complexed with fad, ump; mutant |
PDB Entry: 3n0c (more details), 2.3 Å
SCOPe Domain Sequences for d3n0cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n0cb_ d.207.1.1 (B:) Thy1 homologue {Thermotoga maritima [TaxId: 2336]} mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfehi vftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervte kiseivdkayrtyleliesgvprevarivlplnlytrafatvnarslmnflnlradshaq weiqqyalaiarifkekcpwtfeaflkyaykgdilkevqv
Timeline for d3n0cb_:
View in 3D Domains from other chains: (mouse over for more information) d3n0ca1, d3n0ca2, d3n0cc_, d3n0cd_ |