Lineage for d3n0ca1 (3n0c A:1-215)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006302Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
    complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354
  4. 3006303Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (2 families) (S)
    automatically mapped to Pfam PF02511
  5. 3006304Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins)
  6. 3006305Protein Thy1 homologue [69798] (1 species)
  7. 3006306Species Thermotoga maritima [TaxId:2336] [69799] (29 PDB entries)
    TM0449
  8. 3006383Domain d3n0ca1: 3n0c A:1-215 [181747]
    Other proteins in same PDB: d3n0ca2
    automated match to d1kq4b_
    complexed with fad, ump; mutant

Details for d3n0ca1

PDB Entry: 3n0c (more details), 2.3 Å

PDB Description: tm0449 mutant crystal grown by hanging drop method
PDB Compounds: (A:) Thymidylate synthase thyX

SCOPe Domain Sequences for d3n0ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n0ca1 d.207.1.1 (A:1-215) Thy1 homologue {Thermotoga maritima [TaxId: 2336]}
mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfehi
vftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervte
kiseivdkayrtyleliesgvprevarivlplnlytrafatvnarslmnflnlradshaq
weiqqyalaiarifkekcpwtfeaflkyaykgdil

SCOPe Domain Coordinates for d3n0ca1:

Click to download the PDB-style file with coordinates for d3n0ca1.
(The format of our PDB-style files is described here.)

Timeline for d3n0ca1: