Lineage for d3n0ca_ (3n0c A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1050676Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
    complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354
  4. 1050677Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (1 family) (S)
  5. 1050678Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins)
  6. 1050717Protein automated matches [191028] (2 species)
    not a true protein
  7. 1050718Species Thermotoga maritima [TaxId:2336] [188857] (3 PDB entries)
  8. 1050723Domain d3n0ca_: 3n0c A: [181747]
    automated match to d1kq4b_
    complexed with fad, ump; mutant

Details for d3n0ca_

PDB Entry: 3n0c (more details), 2.3 Å

PDB Description: tm0449 mutant crystal grown by hanging drop method
PDB Compounds: (A:) Thymidylate synthase thyX

SCOPe Domain Sequences for d3n0ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n0ca_ d.207.1.1 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
hmkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfeh
ivftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervt
ekiseivdkayrtyleliesgvprevarivlplnlytrafatvnarslmnflnlradsha
qweiqqyalaiarifkekcpwtfeaflkyaykgdil

SCOPe Domain Coordinates for d3n0ca_:

Click to download the PDB-style file with coordinates for d3n0ca_.
(The format of our PDB-style files is described here.)

Timeline for d3n0ca_: